3.15 Rating by CuteStat

seasidemontereydownsandveteranscemeteryspecificplan.com is 6 years 5 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, seasidemontereydownsandveteranscemeteryspecificplan.com is SAFE to browse.

PageSpeed Score
89
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.24.106.103

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.24.106.103)

SBA Small Business Accounting NZ | Accounting Experts

- sba.co.nz

Leave the accounting to the experts at SBA so you can do what you really love. SBA is the first choice for small businesses throughout New Zealand.

2,633,513 $ 480.00

503 Service Temporarily Unavailable

- sapphire-magazine.com
Not Applicable $ 8.95

Most-Security

- most-security.com

Hacking Tools, FUD Tools, Scanner, Programacion, Source Codes

2,446,790 $ 480.00

Site Not Configured | 404 Not Found

- mightyoutdoors.com
Not Applicable $ 8.95

Apache HTTP Server Test Page powered by CentOS

- easyfinanceaction.click
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 09 Dec 2017 18:53:40 GMT
Content-Type: text/html; charset=UTF-8
Last-Modified: Fri, 08 Dec 2017 20:51:50 GMT
Server: cloudflare-nginx
CF-RAY: 3caa2b2927a99242-EWR
Content-Encoding: gzip
X-Cache: MISS from proxy-node-002
X-Cache-Lookup: MISS from proxy-node-002:4896
Transfer-Encoding: chunked
Via: 1.1 proxy-node-002 (squid/3.5.12)
Connection: keep-alive

Domain Information

Domain Registrar: Internet Domain Service BS Corp.
Registration Date: Dec 8, 2017, 12:00 AM 6 years 5 months 1 week ago
Last Modified: Dec 8, 2017, 12:00 AM 6 years 5 months 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ben.ns.cloudflare.com 108.162.193.103 United States of America United States of America
kristin.ns.cloudflare.com 173.245.58.181 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
seasidemontereydownsandveteranscemeteryspecificplan.com A 300 IP: 104.24.107.103
seasidemontereydownsandveteranscemeteryspecificplan.com A 300 IP: 104.24.106.103
seasidemontereydownsandveteranscemeteryspecificplan.com NS 86400 Target: kristin.ns.cloudflare.com
seasidemontereydownsandveteranscemeteryspecificplan.com NS 86400 Target: ben.ns.cloudflare.com
seasidemontereydownsandveteranscemeteryspecificplan.com SOA 3600 MNAME: ben.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2026442209
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
seasidemontereydownsandveteranscemeteryspecificplan.com AAAA 300 IPV6: 2400:cb00:2048:1::6818:6b67
seasidemontereydownsandveteranscemeteryspecificplan.com AAAA 300 IPV6: 2400:cb00:2048:1::6818:6a67

Full WHOIS Lookup

Domain Name: SEASIDEMONTEREYDOWNSANDVETERANSCEMETERYSPECIFICPLAN.COM
Registry Domain ID: 2197286830_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.internet.bs
Registrar URL: http://www.internet.bs
Updated Date: 2017-12-08T16:48:22Z
Creation Date: 2017-12-08T13:46:54Z
Registry Expiry Date: 2019-12-08T13:46:54Z
Registrar: Internet Domain Service BS Corp
Registrar IANA ID: 2487
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: BEN.NS.CLOUDFLARE.COM
Name Server: KRISTIN.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-12-09T18:53:33Z